PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 74aa    MW: 8871.11 Da    PI: 11.2278
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22221.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM101.61.1e-3137455127
        NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + +   +++g++ktLvfy+grap+g+k+dW+mheyr
  PK22221.1   3 QSEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRN-AFKKIGMRKTLVFYRGRAPHGQKSDWIMHEYR 74 
                579************************************9.8899***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.846174IPR003441NAC domain
SuperFamilySSF1019412.62E-30374IPR003441NAC domain
PfamPF023655.5E-16674IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
TPQSEWYFFS HKDRKYPTGS RTNRATNAGF WKATGRDKCI RNAFKKIGMR KTLVFYRGRA  60
PHGQKSDWIM HEYR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-2837473144NAC domain-containing protein 19
3swm_B3e-2837473144NAC domain-containing protein 19
3swm_C3e-2837473144NAC domain-containing protein 19
3swm_D3e-2837473144NAC domain-containing protein 19
3swp_A3e-2837473144NAC domain-containing protein 19
3swp_B3e-2837473144NAC domain-containing protein 19
3swp_C3e-2837473144NAC domain-containing protein 19
3swp_D3e-2837473144NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009757635.17e-49PREDICTED: protein BEARSKIN1
RefseqXP_016556495.15e-48PREDICTED: protein BEARSKIN2
SwissprotQ9SV871e-47BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A067E8455e-48A0A067E845_CITSI; Uncharacterized protein (Fragment)
TrEMBLK4C7747e-48K4C774_SOLLC; Uncharacterized protein
STRINGSolyc06g063430.1.12e-47(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.16e-49NAC domain containing protein 70